RHybridFinder is a package for the analysis of Mass spectrometry (MS) for the discovery of putative hybrid peptides. For the analysis of your sample, please note that the proposed workflow in the context of this package consists of two major steps:
After installing the package and in order to be able to use the package, it has to be loaded
For demonstration purposes, the data showcased in this vignette, which is also available in the package (denovo sequencing and database search results, in .csv format) is from HLA Ligand Atlas (Human liver, Autonomous Donor 17) (Marcu et al., 2020). In order to download the human proteome database .fasta file, please visit the uniProt website.
In order to access the example denovo sequencing results and database search results through the package:
#retrieve the denovo sequencing results for the example data
data(package="RHybridFinder", denovo_Human_Liver_AUTD17)
#retrieve the database search results for the example data
data(package="RHybridFinder", db_Human_Liver_AUTD17)
The RAW Mass Spectrometry (MS) Files for the dataset are provided by the authors on Proteomics Identifications Database (PRIDE): PXD019643
The step 1 consists of running the HybridFinder function.
The HybridFinder function is based on the workflow proposed by Faridi et al. (2018), with some modifications. Whereby, while using denovo sequencing results with database search results and the proteome database, HybridFinder extracts High confidence denovo peptides and then goes through a 3-step search of these into the proteome. If peptide sequences are matched fully within proteins then they are considered as being “Linear” and Linear peptides within a given spectrum are filtered based on the highest ALC (Average Local Confidence: a significance score for the sequence) score. The rest of the spectra go through the second step during which lists of pair fragments from each peptide sequence are created and then searched in the proteome database, if pair fragments are matched within one protein, these are considered to be potentially cis-spliced. Then, only the highest ALC peptides from each spectrum group are kept. The rest of the spectra goes through the last step, which consists of searching for pair combination matches within two proteins, those that match are considered as being potentially trans-spliced, and only the highest ALC peptides within each spectrum group are kept. Finally, the list of hybrid candidates are concatenated into different ‘fake’ proteins, with the goal being the creation of a hybrid proteome which would mimic the actual proteome. And this hybrid proteome is merged with the reference proteome.
In order to run HybridFinder, three inputs must be provided to HybridFinder
Please note that it is recommended to have a folder structure that looks as follows, as it helps keep all results organized:
folder_Human_Liver_AUTD17 <- file.path("./data/Human_Liver_AUTD17")
denovo_Human_Liver_AUTD17 <- read.csv(file.path(folder_Human_Liver_AUTD17, "first_run","all de novo candidates.csv"), sep=",", head=TRUE,stringsAsFactors = FALSE)
db_Human_Liver_AUTD17 <- read.csv(file.path(folder_Human_Liver_AUTD17, "first_run","DB search psm.csv"), sep=",", head=TRUE,stringsAsFactors = FALSE)
proteome_Human_Liver_AUTD17<- file.path(folder_Human_Liver_AUTD17, "uniprot-proteome-human_UP000005640-reviewed_validated.fasta")
Once the inputs are loaded, running HybridFinder is a piece of cake. Please note that the HybridFinder function can use parallel computing in order to obtain results fast. It will be good to make sure whether the PC used can support that.
The function returns a list composed of 3 elements
#display HybridFinder(HF) step1 output
print(head(results_HybridFinder_Human_Liver_AUTD17[[1]]))
#> Fraction Scan m/z RT Peptide Length Potential_spliceType ALC
#> 398 1 F1:12157 574.2689 61.13 NYGELFEKF 9 cis 92
#> 10 1 F1:10576 569.8348 55.81 KLADRFLLY 9 Linear 89
#> 405 1 F1:12242 574.2689 61.13 DYGELFEKF 9 cis 89
#> 97 1 F1:16670 575.7930 72.95 SYLEHLFEL 9 Linear 93
#> 355 3 F3:16765 575.7935 72.81 SYLEHLFEL 9 Linear 91
#> 58 1 F1:14442 509.8185 68.48 LLDPHVVLL 9 Linear 82
#> proteome_database_used
#> 398 uniprot-proteome-human_UP000005640-reviewed_validated.fasta
#> 10 uniprot-proteome-human_UP000005640-reviewed_validated.fasta
#> 405 uniprot-proteome-human_UP000005640-reviewed_validated.fasta
#> 97 uniprot-proteome-human_UP000005640-reviewed_validated.fasta
#> 355 uniprot-proteome-human_UP000005640-reviewed_validated.fasta
#> 58 uniprot-proteome-human_UP000005640-reviewed_validated.fasta
#display the merged proteome
print(tail(results_HybridFinder_Human_Liver_AUTD17[[3]]))
#> $`sp|Q8TDM6-2|DLG5_HUMAN`
#> [1] "MEPQRRELLAQCQQSLAQAMTEVEAVLGLLEAAGALSPGERRQLDEEAGGAKAELLLKLLLAKERDHFQDLRAALEKTQPHLLPLLYLNGVVGPPQPAEGAGSTYSVLSTMPSDSESSSSLSSVGTTGKAPSPPPLLTDQQVNEKVENLSLQLRLMTRERNELRKRLAFATHGTAFDKRPYHRLNPDYERLKLQCVRAMSDLQSLQNQHTNALKRCEEVAKETDFYHTLHSRLLSDQTRLKDDVDMLRRENGQLLRERNLLQQSWEDMKRLHEEDQKELGDLRAQQQQVLKHNGSSELLNKLYDTAMDKLEVVKKDYDALRKRYSEKVALHNADLSRLEQLGEENQRLLKQTEMLTQQRDTALQLQHQCALSLRRFEALHHELNKATAQNKDLQWEMELLQSELTELRTTQVKTAKESEKYREERDAVYSEYKLLMSERDQVLSELDKLQTEVELAESKLKSSTSEKKAANEEMEALRQLKDTVTMDAGRANKEVELLRKQCKALCQELKEALQEADVAKCRRDWAFQERDKLVAERDSLRTLCDNLRRERDRAVSELAEALRSLDDTRKQKNDVSRELKELKEQMESQLEKEARFRQLMAHSSHDSALDTDSMEWETEVVEFERETEDLDLKALGFDMAEGVNEPCFPGDCGLFVTKVDKGSLADGRLRVNDWLLRLNDVDLLNKDKKQALKALLNGEGALNMVVRRRKSLGGKVVTPLHLNLSGQKDSGLSLENGVYAAAVLPGSPAAKEGSLAVGDRLVALNGLALDNKSLNECESLLRSCQDSLTLSLLKEQKCVPASGELSPELQEWAPYSPGHSSRHSNPPLYPSRPSVGTVPRSLTPSTTVSSLLRNPLYTVRSHRVGPCSSPPAARDAGPQGLHPSVQHQGRLSLDLSHRTCSDYSEMRATHGSNSLPSSARLGSSSNLQFKAERLKLPSTPRYPRSVVGSERGSVSHSECSTPPQSPLNLDTLSSCSQSQTSASTLPRLAVNPASLGERRKDRPYVEEPRHVKVQKGSEPLGLSLVSGEKGGLYVSKVTVGSLAHQAGLEYGDQLLEFNGLNLRSATEQQARLLLGQQCDTLTLLAQYNPHVHQLSSHSRSSSHLDPAGTHSTLQGSGTTTPEHPSVLDPLMEQDEGPSTPPAKQSSSRLAGDANKKTLEPRVVFLKKSQLELGVHLCGGNLHGVFVAEVEDDSPAKGPDGLVPGDLLLEYGSLDVRNKTVEEVYVEMLKPRDGVRLKVQYRPEEFTKAKGLPGDSFYLRALYDRLADVEQELSFKKDDLLYVDDTLPQGTFGSWMAWQLDENAQKLQRGQLPSKYVMDQEFSRRLSMSEVKDDNSATKTLSAAARRSFFRRKHKHKRSGSKDGKDLLALDAFSSDSLPLFEDSVSLAYQRVQKVDCTALRPVLLLGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQQALERGVKDCLFVDYKRRSGHFDVTTVASLKELTEKNRHCLLDLAPHALERLHHMHLYPLVLFLHYKSAKHLKEQRDPLYLRDKVTQRHSKEQFEAAQKLEQEYSRYFTGVLQGGALSSLCTQLLAMVNQEQNKVLWLPACPL"
#> attr(,"name")
#> [1] "sp|Q8TDM6-2|DLG5_HUMAN"
#> attr(,"Annot")
#> [1] ">sp|Q8TDM6-2|DLG5_HUMAN Isoform 2 of Disks large homolog 5 OS=Homo sapiens OX=9606 GN=DLG5"
#> attr(,"class")
#> [1] "SeqFastaAA"
#>
#> $`sp|Q8TDM6-3|DLG5_HUMAN`
#> [1] "MEPQRRELLAQCQQSLAQAMTEVEAVLGLLEAAGALSPGERRQLDEEAGGAKAELLLKLLLAKERDHFQDLRAALEKTQPHLLPLLYLNGVVGPPQPAEGAGSTYSVLSTMPSDSESSSSLSSVGTTGKELKEQMESQLEKEARFRQLMAHSSHDSALDTDSMEWETEVVEFERETEDLDLKALGFDMAEGVNEPCFPGDCGLFVTKVDKGSLADGRLRVNDWLLRLNDVDLLNKDKKQALKALLNGEGALNMVVRRRKSLGGKVVTPLHLNLSGQKDSGLSLENGVYAAAVLPGSPAAKEGSLAVGDRLVALNGLALDNKSLNECESLLRSCQDSLTLSLLKVFPQSSSWSGQNLFENLKDSDKMLSFRAHGPEVQAHNKRNLLQHNNSTQTDLFYTDRLEDRKEPGPPGGSSSFLHKPFPGGPLQVCPQACPSASERSLSSFRSDASGDRGFGLVDVRGRRPLLPFETEVGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEKLSVYKKPKQRKSLFDPNTFKRPQTPPKLDYLLPGPGPAHSPQPSKRAGPLTPPKPPRRSDSLKFQHRLETSSESEATLVGSSPSTSPPSALPPDVDPGEPMHASPPRKARVRLASSYYPEGDGDSSHLPAKKSCDEDLTSQKVDELGQKRRRPKSAPSFRPKLAPVVLPAQFLEV"
#> attr(,"name")
#> [1] "sp|Q8TDM6-3|DLG5_HUMAN"
#> attr(,"Annot")
#> [1] ">sp|Q8TDM6-3|DLG5_HUMAN Isoform 3 of Disks large homolog 5 OS=Homo sapiens OX=9606 GN=DLG5"
#> attr(,"class")
#> [1] "SeqFastaAA"
#>
#> $`sp|Q8TDM6-4|DLG5_HUMAN`
#> [1] "MPSDSESSSSLSSVGTTGKAPSPPPLLTDQQVNEKVENLSLQLRLMTRERNELRKRLAFATHGTAFDKRPYHRLNPDYERLKLQCVRAMSDLQSLQNQHTNALKRCEEVAKETDFYHTLHSRLLSDQTRLKDDVDMLRRENGQLLRERNLLQQSWEDMKRLHEEDQKELGDLRAQQQQVLKHNGSSELLNKLYDTAMDKLEVVKKDYDALRKRYSEKVALHNADLSRLEQLGEENQRLLKQTEMLTQQRDTALQLQHQCALSLRRFEALHHELNKATAQNKDLQWEMELLQSELTELRTTQVKTAKESEKYREERDAVYSEYKLLMSERDQVLSELDKLQTEVELAESKLKSSTSEKKAANEEMEALRQLKDTVTMDAGRANKEVELLRKQCKALCQELKEALQEADVAKCRRDWAFQERDKLVAERDSLRTLCDNLRRERDRAVSELAEALRSLDDTRKQKNDVSRELKELKEQMESQLEKEARFRQLMAHSSHDSALDTDSMEWETEVVEFERETEDLDLKALGFDMAEGVNEPCFPGDCGLFVTKVDKGSLADGRLRVNDWLLRLNDVDLLNKDKKQALKALLNGEGALNMVVRRRKSLGGKVVTPLHLNLSGQKDSGLSLENGVYAAAVLPGSPAAKEGSLAVGDRLVALNGLALDNKSLNECESLLRSCQDSLTLSLLKVFPQSSSWSGQNLFENLKDSDKMLSFRAHGPEVQAHNKRNLLQHNNSTQTDLFYTDRLEDRKEPGPPGGSSSFLHKPFPGGPLQVCPQACPSASERSLSSFRSDASGDRGFGLVDVRGRRPLLPFETEVGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEKLSVYKKPKQRKSLFDPNTFKRPQTPPKLDYLLPGPGPAHSPQPSKRAGPLTPPKPPRRSDSLKFQHRLETSSESEATLVGSSPSTSPPSALPPDVDPGEPMHASPPRKARVRLASSYYPEGDGDSSHLPAKKSCDEDLTSQKVDELGQKRRRPKSAPSFRPKLAPVVLPAQFLEEQKCVPASGELSPELQEWAPYSPGHSSRHSNPPLYPSRPSVGTVPRSLTPSTTVSSLLRNPLYTVRSHRVGPCSSPPAARDAGPQGLHPSVQHQGRLSLDLSHRTCSDYSEMRATHGSNSLPSSARLGSSSNLQFKAERLKLPSTPRYPRSVVGSERGSVSHSECSTPPQSPLNLDTLSSCSQSQTSASTLPRLAVNPASLGERRKDRPYVEEPRHVKVQKGSEPLGLSLVSGEKGGLYVSKVTVGSLAHQAGLEYGDQLLEFNGLNLRSATEQQARLLLGQQCDTLTLLAQYNPHVHQLSSHSRSSSHLDPAGTHSTLQGSGTTTPEHPSVLDPLMEQDEGPSTPPAKQSSSRLAGDANKKTLEPRVVFLKKSQLELGVHLCGGNLHGVFVAEVEDDSPAKGPDGLVPGDLLLEYGSLDVRNKTVEEVYVEMLKPRDGVRLKVQYRPEEFTKAKGLPGDSFYLRALYDRLADVEQELSFKKDDLLYVDDTLPQGTFGSWMAWQLDENAQKLQRGQLPSKYVMDQEFSRRLSMSEVKDDNSATKTLSAAARRSFFRRKHKHKRSGSKDGKDLLALDAFSSDSLPLFEDSVSLAYQRVQKVDCTALRPVLLLGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQQALERGVKDCLFVDYKRRSGHFDVTTVASLKELTEKNRHCLLDLAPHALERLHHMHLYPLVLFLHYKSAKHLKEQRDPLYLRDKVTQRHSKEQFEAAQKLEQEYSRYFTGVLQGGALSSLCTQLLAMVNQEQNKVLWLPACPL"
#> attr(,"name")
#> [1] "sp|Q8TDM6-4|DLG5_HUMAN"
#> attr(,"Annot")
#> [1] ">sp|Q8TDM6-4|DLG5_HUMAN Isoform 4 of Disks large homolog 5 OS=Homo sapiens OX=9606 GN=DLG5"
#> attr(,"class")
#> [1] "SeqFastaAA"
#>
#> $`sp|Q8TDM6-5|DLG5_HUMAN`
#> [1] "MRATHGSNSLPSSARLGSSSNLQFKAERLKLPSTPRYPRSVVGSERGSVSHSECSTPPQSPLNLDTLSSCSQSQTSASTLPRLAVNPASLGERRKDRPYVEEPRHVKVQKGSEPLGLSLVSGEKGGLYVSKVTVGSLAHQAGLEYGDQLLEFNGLNLRSATEQQARLLLGQQCDTLTLLAQYNPHVHQLSSHSRSSSHLDPAGTHSTLQGSGTTTPEHPSVLDPLMEQDEGPSTPPAKQSSSRLAGDANKKTLEPRVVFLKKSQLELGVHLCGGNLHGVFVAEVEDDSPAKGPDGLVPGDLLLEYGSLDVRNKTVEEVYVEMLKPRDGVRLKVQYRPEEFTKAKGLPGDSFYLRALYDRLADVEQELSFKKDDLLYVDDTLPQGTFGSWMAWQLDENAQKLQRGQLPSKYVMDQEFSRRLSMSEVKDDNSATKTLSAAARRSFFRRKHKHKRSGSKDGKDLLALDAFSSDSLPLFEDSVSLAYQRVQKVDCTALRPVLLLGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQQALERGVKDCLFVDYKRRSGHFDVTTVASLKELTEKNRHCLLDLAPHALERLHHMHLYPLVLFLHYKSAKHLKEQRDPLYLRDKVTQRHSKEQFEAAQKLEQEYSRYFTGVLQGGALSSLCTQLLAMVNQEQNKVLWLPACPL"
#> attr(,"name")
#> [1] "sp|Q8TDM6-5|DLG5_HUMAN"
#> attr(,"Annot")
#> [1] ">sp|Q8TDM6-5|DLG5_HUMAN Isoform 5 of Disks large homolog 5 OS=Homo sapiens OX=9606 GN=DLG5"
#> attr(,"class")
#> [1] "SeqFastaAA"
#>
#> $`sp|denovo_HF_fake_protein1`
#> [1] "KAVNLLLSYAKVNLLLSYKLADFRLLYKLADLFRLYNYGELFEKFDYGELFEKFDYGELFQKFKLADFLRLYYKPSPFFVFYNLPWLENLLEPFLLPTLPELFLLPTLLYEQFVPLLLEYQFVPLLPLEFLLPTLLTTSWMSLKEQLPLRLSAQELPLRLSASEAPPTNGAALPYFSPCLELLPENLLHALMEDLLKLLAMENLLKLLAYPDLNFRNLLPVDLQRYLLPVNLQRYLLYEVLLKNFFPYYAPELLPFYYAPELLFSVHMVTHFLLYYASNYRRFLVGSLPKESAPPTNQAFENGEWRELQLADLFRLYEFTQHLFEL"
#>
#> $`sp|denovo_HF_fake_protein2`
#> [1] "LTMNLVQELLTMDLVQELLTMDLVQQLLWDLSLTRLYLNPSFTVLYKPSFPFVFKYPSMLFVFYKPSLMFVFKYPSLMFVFDQDLRSMATALLYYASNRYLLYYASRNYSLVMTQTPKFLLTTMSLGSFLLTERYGSFFYGKQAVQFYKVYTSVSWMMALLTHGLLMMAKVFVFSYLPLAHFMAYVSELFPAFSFVSELFPAFSYLHELFELNYLPWLELNYVLAQAVLSLTVVMTQTPKFRYFSTSVSWYRFSTSVSWLTFVPGAMVLPVDLTAFQLLPVNLATFQLLPVDLATFQLLPVNLKSLTMSYLEHLFYTLPEMWFPLL"
If export is set to TRUE
and a valid directory is provided in export_dir
, then the results are exported .csv, .csv and .fasta format, respectively.
Even if the export parameters were not set at the beginning, the results returned can always be exported with the export_HybridFinder_results
function as long as as the results obtained from the HybridFinder function are stored which is also indicated in the results_list parameter of the export_HybridFinder_results
function.
After finishing this, a second database search has to be done on the raw MS however with the merged proteome (.fasta) exported from the HybridFinder function results.
The second step in RHybridFinder consists of either using checknetMHCpan
or step2_wo_netMHCpan
, while using the results from step 1 in order to retrieve for the final list of peptides which includes the hybrid candidates, their potential splice types.
the checknetMHCpan
function represents step 2 of Faridi et al. (2018)’s workflow and also features the use of netMHCpan (Jurtz et al., 2017, Reynisson et al., 2020) for obtaining the peptide-MHC-I predicted binding affinities. Please note that netMHCpan needs to be installed in order to be able to run this function. The package also contains a function that runs step2 without netMHCpan (Please refer to the step2_wo_netMHCpan
part).
In order to run checknetMHCpan, four inputs must be provided to checknetMHCpan
HybridFinder
output.netmhcpan_dir<- '/usr/bin/'
alleles_Human_liver_AUTD17<- c("HLA-A*03:01", "HLA-A*24:02", "HLA-B*35:03", "HLA-B*45:01", "HLA-C*04:01", "HLA-C*16:01")
db_rerun_Human_liver_AUTD17 <- read.csv(file.path(folder_Human_Liver_AUTD17, "second_run","DB search psm.csv"), sep=",", head=TRUE,stringsAsFactors = FALSE)
HF_output_Human_liver_AUTD17<- results_HybridFinder_Human_Liver_AUTD17[[1]]
Once the inputs are loaded, running checknetMHCpan is easier than ABC.
The function returns a list composed of 3 elements: - the netMHCpan results in long format, that is the binding affinity results are displayed for each peptide with a given allele from those chosen. - the netMHCpan results in wide format, that is the binding affinity levels per peptide summarized for all HLA alleles chosen. - the database results with the respective potential splice types retrieved from step 1
#display netmhcpan output(long version)
print(head(results_checknetMHCpan_Human_Liver_AUTD17[[1]]))
#> Pos HLA Peptide Core Of Gp Gl Ip Il Icore Identity
#> 5 1 HLA-A*03:01 DYENLFLKF DYENLFLKF 0 0 0 0 0 DYENLFLKF PEPLIST
#> 6 1 HLA-A*03:01 RYFSTSVSW RYFSTSVSW 0 0 0 0 0 RYFSTSVSW PEPLIST
#> 7 1 HLA-A*03:01 AFSHLLLTTM AFSHLLLTM 0 7 1 0 0 AFSHLLLTTM PEPLIST
#> 8 1 HLA-A*03:01 PYMARVAFF PYMARVAFF 0 0 0 0 0 PYMARVAFF PEPLIST
#> 9 1 HLA-A*03:01 LYRPTAAAF LYRPTAAAF 0 0 0 0 0 LYRPTAAAF PEPLIST
#> 10 1 HLA-A*03:01 FPVELAKYYM FVELAKYYM 0 1 1 0 0 FPVELAKYYM PEPLIST
#> Score Aff(nM) %Rank BindLevel strongBinder weakBinder noneBinder
#> 5 0.0232400 38883.6 68.5113 Non binder HLA-A*03:01
#> 6 0.0939940 18084.0 14.1393 Non binder HLA-A*03:01
#> 7 0.0874160 19418.0 15.5482 Non binder HLA-A*03:01
#> 8 0.0423440 31622.6 38.9120 Non binder HLA-A*03:01
#> 9 0.0728480 22733.1 19.7710 Non binder HLA-A*03:01
#> 10 0.0459210 30422.0 35.4191 Non binder HLA-A*03:01
#> Potential_spliceType
#> 5 Linear
#> 6 trans
#> 7 Linear
#> 8 Linear
#> 9 Linear
#> 10 Linear
#display netmhcpan output tidied version (wide)
print(head(results_checknetMHCpan_Human_Liver_AUTD17[[2]]))
#> Peptide strongBinder weakBinder
#> 1 AAEYPSVTNYL HLA-A*24:02
#> 7 AAFFEEPEL HLA-B*35:03,HLA-C*16:01
#> 13 AAMLDTVVFK HLA-A*03:01
#> 19 AANPHSFVF HLA-B*35:03,HLA-C*04:01,HLA-C*16:01 HLA-A*24:02
#> 25 AANPNGRYY HLA-C*16:01
#> 31 AAPPQLRALL
#> noneBinder
#> 1 HLA-A*03:01,HLA-B*35:03,HLA-B*45:01,HLA-C*04:01,HLA-C*16:01
#> 7 HLA-A*03:01,HLA-A*24:02,HLA-B*45:01,HLA-C*04:01
#> 13 HLA-A*24:02,HLA-B*35:03,HLA-B*45:01,HLA-C*04:01,HLA-C*16:01
#> 19 HLA-A*03:01,HLA-B*45:01
#> 25 HLA-A*03:01,HLA-A*24:02,HLA-B*35:03,HLA-B*45:01,HLA-C*04:01
#> 31 HLA-A*03:01,HLA-A*24:02,HLA-B*35:03,HLA-B*45:01,HLA-C*04:01,HLA-C*16:01
#> %Rank.HLA-B*35:03 %Rank.HLA-A*24:02 %Rank.HLA-C*04:01 %Rank.HLA-A*03:01
#> 1 13.2675 1.3806 2.8884 19.5261
#> 7 1.0785 27.1675 10.0025 43.1042
#> 13 8.8987 18.3151 11.6722 0.1091
#> 19 0.3034 1.2434 0.2483 8.6520
#> 25 7.0735 38.2717 3.5019 5.3500
#> 31 6.9323 10.8503 5.7910 44.3338
#> %Rank.HLA-B*45:01 %Rank.HLA-C*16:01 strongBinder_count weakBinder_count
#> 1 5.5163 10.6324 0 1
#> 7 45.5616 0.6543 0 2
#> 13 10.4367 7.4449 1 0
#> 19 9.1652 0.0156 3 1
#> 25 21.7060 0.5745 0 1
#> 31 73.9918 4.4549 0 0
#> noneBinder_count Potential_spliceType
#> 1 5 Linear
#> 7 4 Linear
#> 13 5 Linear
#> 19 2 Linear
#> 25 5 Linear
#> 31 6 Linear
#display the updated database search results with the categorizations from step1
print(head(results_checknetMHCpan_Human_Liver_AUTD17[[3]]))
#> Peptide X.10lgP Mass Length ppm m.z Z RT Area Fraction Id
#> 1 DYENLFLKF 23.98 1187.586 9 0.1 594.8004 2 73.2 243590 3 44426
#> 2 DYENLFLKF 23.72 1187.586 9 0.1 594.8004 2 73.2 243590 3 44427
#> 3 DYENLFLKF 23.13 1187.586 9 0.1 594.8004 2 73.2 243590 3 44428
#> 4 DYENLFLKF 22.98 1187.586 9 0.1 594.8004 2 73.2 243590 3 44429
#> 5 DYENLFLKF 22.70 1187.586 9 0.1 594.8004 2 73.2 243590 3 44430
#> 6 DYENLFLKF 20.88 1187.586 9 0.1 594.8004 2 73.2 243590 3 44432
#> Scan from.Chimera
#> 1 F3:16451 No
#> 2 F3:16501 No
#> 3 F3:16546 No
#> 4 F3:16609 No
#> 5 F3:16633 No
#> 6 F3:16686 No
#> Source.File
#> 1 171002_AM_BD-ZH17_Liver_W_10%_DDA_#3_400-650mz_msms6.mzML
#> 2 171002_AM_BD-ZH17_Liver_W_10%_DDA_#3_400-650mz_msms6.mzML
#> 3 171002_AM_BD-ZH17_Liver_W_10%_DDA_#3_400-650mz_msms6.mzML
#> 4 171002_AM_BD-ZH17_Liver_W_10%_DDA_#3_400-650mz_msms6.mzML
#> 5 171002_AM_BD-ZH17_Liver_W_10%_DDA_#3_400-650mz_msms6.mzML
#> 6 171002_AM_BD-ZH17_Liver_W_10%_DDA_#3_400-650mz_msms6.mzML
#> Accession PTM AScore Found.By Peptide_no_mods
#> 1 |denovo_HF_fake_protein9 PEAKS DB DYENLFLKF
#> 2 |denovo_HF_fake_protein9 PEAKS DB DYENLFLKF
#> 3 |denovo_HF_fake_protein9 PEAKS DB DYENLFLKF
#> 4 |denovo_HF_fake_protein9 PEAKS DB DYENLFLKF
#> 5 |denovo_HF_fake_protein9 PEAKS DB DYENLFLKF
#> 6 |denovo_HF_fake_protein9 PEAKS DB DYENLFLKF
#> Potential_spliceType
#> 1 Linear
#> 2 Linear
#> 3 Linear
#> 4 Linear
#> 5 Linear
#> 6 Linear
If export is set to TRUE
and a valid directory is provided in export_dir
, then the results are exported .csv, .tsv (tab-separated) and .csv format, respectively.
Even if the export parameters were not set at the beginning, the results returned can always be exported with the export_checknetMHCpan_results
function as long as as the results obtained from the checknetMHCpan function are stored which is also indicated in the results_list parameter of the export_checknetMHCpan_results
function.
The step2_wo_netMHCpan
, removes peptide modifications and prepare a peptide (.pep) file for use in webversion of netMHCpan, in case netMHCpan is not installed, OS is windows or the user would like to run in another software. Additionally, the function matches peptide sequences in the database search rerun (the second database search where the merged proteome was used), with the predicted splice type obtained from step 1.
The step2_wo_netMHCpan, removes peptide modifications and runs netMHCpan on peptides between 9 and 12-mers. Additionally, the function matches peptide sequences in the database search rerun (the second database search where the merged proteome was used), with predicted splice type obtained from step 1.
In order to run checknetMHCpan, four inputs must be provided to checknetMHCpan
HybridFinder
output.Once the inputs are loaded, running step2_wo_netMHCpan is easier than ABC.
The function returns a list composed of 2 elements: - a character vector containing the list of unique peptides from the database search rerun without modifications and of length 9 to 12 amino acids - the database results with the respective potential splice types retrieved from step 1
#display the updated database search results table with the categorizations from
#step1
print(head(results_step2_Human_Liver_AUTD17[[2]]))
#> Peptide X.10lgP Mass Length ppm m.z Z RT Area Fraction Id
#> 1 DYENLFLKF 23.98 1187.586 9 0.1 594.8004 2 73.2 243590 3 44426
#> 2 DYENLFLKF 23.72 1187.586 9 0.1 594.8004 2 73.2 243590 3 44427
#> 3 DYENLFLKF 23.13 1187.586 9 0.1 594.8004 2 73.2 243590 3 44428
#> 4 DYENLFLKF 22.98 1187.586 9 0.1 594.8004 2 73.2 243590 3 44429
#> 5 DYENLFLKF 22.70 1187.586 9 0.1 594.8004 2 73.2 243590 3 44430
#> 6 DYENLFLKF 20.88 1187.586 9 0.1 594.8004 2 73.2 243590 3 44432
#> Scan from.Chimera
#> 1 F3:16451 No
#> 2 F3:16501 No
#> 3 F3:16546 No
#> 4 F3:16609 No
#> 5 F3:16633 No
#> 6 F3:16686 No
#> Source.File
#> 1 171002_AM_BD-ZH17_Liver_W_10%_DDA_#3_400-650mz_msms6.mzML
#> 2 171002_AM_BD-ZH17_Liver_W_10%_DDA_#3_400-650mz_msms6.mzML
#> 3 171002_AM_BD-ZH17_Liver_W_10%_DDA_#3_400-650mz_msms6.mzML
#> 4 171002_AM_BD-ZH17_Liver_W_10%_DDA_#3_400-650mz_msms6.mzML
#> 5 171002_AM_BD-ZH17_Liver_W_10%_DDA_#3_400-650mz_msms6.mzML
#> 6 171002_AM_BD-ZH17_Liver_W_10%_DDA_#3_400-650mz_msms6.mzML
#> Accession PTM AScore Found.By Peptide_no_mods
#> 1 |denovo_HF_fake_protein9 PEAKS DB DYENLFLKF
#> 2 |denovo_HF_fake_protein9 PEAKS DB DYENLFLKF
#> 3 |denovo_HF_fake_protein9 PEAKS DB DYENLFLKF
#> 4 |denovo_HF_fake_protein9 PEAKS DB DYENLFLKF
#> 5 |denovo_HF_fake_protein9 PEAKS DB DYENLFLKF
#> 6 |denovo_HF_fake_protein9 PEAKS DB DYENLFLKF
#> Potential_spliceType
#> 1 Linear
#> 2 Linear
#> 3 Linear
#> 4 Linear
#> 5 Linear
#> 6 Linear
If export is set to TRUE
and a valid directory is provided in export_dir
, then the results are exported .csv, .csv and csv format, respectively.
Even if the export parameters were not set at the beginning, the results returned can always be exported with the export_step2_results
function as long as as the results obtained from the step2_wo_netMHCpan function are stored which is also indicated in the results_list parameter of the export_step2_results
function.
Faridi, P., Li, C., Ramarathinam, S. H., Vivian, J. P., Illing, P. T., Mifsud, N. A., Ayala, R., Song, J., Gearing, L. J., Hertzog, P. J., Ternette, N., Rossjohn, J., Croft, N. P., & Purcell, A. W. (2018). A subset of HLA-I peptides are not genomically templated: Evidence for cis- and trans-spliced peptide ligands. Science Immunology, 3(28), eaar3947. 10.1126/sciimmunol.aar3947, Link
Hanada K, Yewdell JW, Yang JC. Immune recognition of a human renal cancer antigen through post-translational protein splicing. Nature. 2004 Jan 15;427(6971):252-6. DOI 10.1038/nature02240, Link
Marcu A, Bichmann L, Kuchenbecker L, et al HLA Ligand Atlas: a benign reference of HLA-presented peptides to improve T-cell-based cancer immunotherapyJournal for ImmunoTherapy of Cancer 2021;9:e002071. 10.1136/jitc-2020-002071, Link
Birkir Reynisson, Bruno Alvarez, Sinu Paul, Bjoern Peters, Morten Nielsen, NetMHCpan-4.1 and NetMHCIIpan-4.0: improved predictions of MHC antigen presentation by concurrent motif deconvolution and integration of MS MHC eluted ligand data, Nucleic Acids Research, Volume 48, Issue W1, 02 July 2020, Pages W449–W454, 10.1093/nar/gkaa379, Link
Jurtz V, Paul S, Andreatta M, Marcatili P, Peters B, Nielsen M. NetMHCpan-4.0: Improved Peptide-MHC Class I Interaction Predictions Integrating Eluted Ligand and Peptide Binding Affinity Data. J Immunol. 2017 Nov 1;199(9):3360-3368. Epub 2017 Oct 4. PMID: 28978689; PMCID: PMC5679736 10.4049/jimmunol.1700893, Link
The UniProt Consortium, UniProt: the universal protein knowledgebase in 2021, Nucleic Acids Research, Volume 49, Issue D1, 8 January 2021, Pages D480–D489, 10.1093/nar/gkaa1100, Link